CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

28872.m000248 *(Ricinus communis)* NAC/NAM
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF02365 (NAM)	IPR003441	28872.m000248	T296734_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
NAC078 M02372_2.00	Arabidopsis thaliana	NNRCAMGHMANN	NNTKDCKTGYNN	PBM Weirauch et al.(2014) pTH7209	0.938	0.912
NAC078 M07226_2.00	Arabidopsis thaliana	TTDCTTGNDNNDCAAG	CTTGHNNHNCAAGHAA	Dap-seq OMalley et al.(2016) NAC2_colamp_a	0.938	0.912
NAC078 M07227_2.00	Arabidopsis thaliana	DTTWCTTGNNNNRCAAG	CTTGYNNNNCAAGWAAH	Dap-seq OMalley et al.(2016) NAC2_col_v3a	0.938	0.912
NAC078 M11083_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$NAC078_Q2	0.938	0.912
NAC053 M07202_2.00	Arabidopsis thaliana	TTWCTTGNNNVRCAAG	CTTGYBNNNCAAGWAA	Dap-seq OMalley et al.(2016) ANAC053_colamp_a	0.927	0.877
NAC053 M07203_2.00	Arabidopsis thaliana	TTWCTTGNNNVRCAAGH	DCTTGYBNNNCAAGWAA	Dap-seq OMalley et al.(2016) ANAC053_col	0.927	0.877
NAC053 M11079_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AT3G10500_Q2	0.927	0.877
For this family, TFs with SR scores > 0.870* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
28872.m000248	NAC/NAM	12	138	APGFRFHPTDEELVRYYLKRKVTNKPFRFDAIAVVDIYKTEPWDLPDKSKLKTRDLEWYFFSMLDKKYGNGSKTNRATEKGYWKTTGKDRPVRWNSRNVGMKKTLVYHLGRAPRGERTNWVMHEYRL

Links
Other NAC/NAM family TFs
Other *Ricinus communis* TFs