CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

SELMODRAFT_17086 *(Selaginella moellendorffii)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	SELMODRAFT_17086	T005137_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ANT M02647_2.00	Arabidopsis thaliana	DNRCACRNWTCCCVADGYNHW	WDNRCHTBGGGAWNYGTGYNH	SELEX Mathelier et al.(2014) MA0571.1	0.779	0.804
ANT M09705_2.00	Arabidopsis thaliana	CACRNWTCCCRAKG	CMTYGGGAWNYGTG	Transfac Matys et al.(2006) P$ANT_01	0.779	0.804
Q6SA75_TOBAC M09733_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ANTL_01	0.766	0.784
Q6SA75_TOBAC M09734_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ANTL_02	0.766	0.784
PLT1 M06622_2.00	Arabidopsis thaliana	DDCACGNWWHYCRAGRHNN	NNDYCTYGRDWWNCGTGHH	Dap-seq OMalley et al.(2016) PLT1_col_a	0.766	0.784
PLT1 M06623_2.00	Arabidopsis thaliana	DYDCRNWTYYCRAG	CTYGRRAWNYGHRH	Dap-seq OMalley et al.(2016) PLT1_colamp_a	0.766	0.784
AIL7 M06688_2.00	Arabidopsis thaliana	CRNWTHYCRAG	CTYGRDAWNYG	Dap-seq OMalley et al.(2016) AIL7_col_a	0.734	0.763
AIL7 M06689_2.00	Arabidopsis thaliana	DCRNWTHYCRAG	CTYGRDAWNYGH	Dap-seq OMalley et al.(2016) AIL7_colamp_a	0.734	0.763
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EFJ24417	AP2	1	52	SRHRWTRRYEAHLWDNSYKQPGRDRKGRQGGYDSEENAARAYDLAALKYWGP
EFJ24417	AP2	94	146	SVFRGVTRHHQHGRWQARIGRVAGHKDLYLGTFGTEEEAAEAYDRAAIKYRGL

Links
Other AP2 family TFs
Other *Selaginella moellendorffii* TFs

516 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
GE12260	Drosophila yakuba	FBgn0230017	N