CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Aquca_034_00155 *(Aquilegia coerulea)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Aquca_034_00155	T007518_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
RAP2-4 M01612_2.00	Arabidopsis thaliana	NRCCGHCMNN	NNKGDCGGYN	PBM Weirauch et al.(2014) pTH8092	0.837	0.900
ERF055 M06577_2.00	Arabidopsis thaliana	NHDYCACCGHCMHH	DDKGDCGGTGRHDN	Dap-seq OMalley et al.(2016) At1g36060_col_a	0.824	0.880
ERF055 M06578_2.00	Arabidopsis thaliana	NHDYCACCGHCMHH	DDKGDCGGTGRHDN	Dap-seq OMalley et al.(2016) At1g36060_colamp_a	0.824	0.880
AT5G65130 M06686_2.00	Arabidopsis thaliana	YCDYCDCCRCCGCCN	NGGCGGYGGHGRHGR	Dap-seq OMalley et al.(2016) At5g65130_col_a	0.700	0.780
AT5G65130 M06687_2.00	Arabidopsis thaliana	NNNNHNNHDSCRCCGMCMW	WKGKCGGYGSHDNNDNNNN	Dap-seq OMalley et al.(2016) At5g65130_colamp_a	0.700	0.780
WIN1 M01603_2.00	Arabidopsis thaliana	VCRCCGCNNN	NNNGCGGYGB	PBM Weirauch et al.(2014) pTH7566	0.679	0.660
ERF054 M06647_2.00	Arabidopsis thaliana	NNNNNNNNNHHDSCRCCGHC	GDCGGYGSHDDNNNNNNNNN	Dap-seq OMalley et al.(2016) At4g28140_col_a	0.678	0.800
ERF054 M06648_2.00	Arabidopsis thaliana	NNNNHDBCRCCGHCM	KGDCGGYGVHDNNNN	Dap-seq OMalley et al.(2016) At4g28140_colamp_a	0.678	0.800
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Aquca_034_00155.1	AP2	180	231	KLYRGVRQRHWGKWVAEIRLPRNRSRVWLGTFDTAEEAAFAYDTAAYKLRGE

Links
Other AP2 family TFs
Other *Aquilegia coerulea* TFs

455 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
F443_10259	Phytophthora parasitica	F443_10259	N	0.000
HpaG811532	Hyaloperonospora arabidopsidis	HpaG811532	N	0.000
LALA0_S09e02630g	Lachancea lanzarotensis	LALA0_S09e02630g	N	0.000
maker-pag1_scaffold_15-fgenesh-gene-1.10	Pythium aphanidermatum	maker-pag1_scaffold_15-fgenesh-gene-1.10	N	0.000
maker-par_contig_374-snap-gene-0.8	Pythium arrhenomanes	maker-par_contig_374-snap-gene-0.8	N	0.000
maker-piw_contig_840-fgenesh-gene-0.5	Pythium iwayamai	maker-piw_contig_840-fgenesh-gene-0.5	N	0.000
maker-pve_contig_516-snap-gene-0.15	Pythium vexans	maker-pve_contig_516-snap-gene-0.15	N	0.000
Phyra75827	Phytophthora ramorum	Phyra75827	N	0.000
PITG_09522	Phytophthora infestans	PITG_09522	N	0.000
PITG_09630	Phytophthora infestans	PITG_09630	N	0.000
PYU1_G013091	Pythium ultimum	PYU1_G013091	N	0.000