CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GF10774 *(Drosophila ananassae)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	FBgn0087814	T038523_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Max M03612_2.00	Drosophila melanogaster	VRAMCACGTGBTYB	VRAVCACGTGKTYB	SELEX Nitta et al.(2015) Max_1	0.914	1.000
Max M05969_2.00	Drosophila melanogaster	HCCACGTGBY	RVCACGTGGD	B1H Zhu et al.(2011) dm_Max_SANGER_10_FBgn0017578	0.914	1.000
Max M05970_2.00	Drosophila melanogaster	CCACGTG	CACGTGG	B1H Zhu et al.(2011) Max_Mnt_SANGER_5_FBgn0017578	0.914	1.000
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
FBpp0113966	bHLH	40	91	KRAHHNALERRRRDHIKESFTNLREAVPTLKGEKASRAQILKKTTECIQTMR

Links
Other bHLH family TFs
Other *Drosophila ananassae* TFs