CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

AQUA003723 *(Anopheles quadriannulatus)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00010 (HLH)	IPR001092	AQUA003723	T053001_2.00	Vectorbase (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ss M05953_2.00	Drosophila melanogaster	SDTTGCGTGAC	GTCACGCAAHS	B1H Zhu et al.(2011) ss_tgo_SANGER_10_FBgn0003513	0.882	0.980
ss M05954_2.00	Drosophila melanogaster	TGCGTGAC	GTCACGCA	B1H Zhu et al.(2011) tgo_ss_SANGER_5_FBgn0003513	0.882	0.980
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
AQUA003723-PA	bHLH	15	63	TKSNPSKRHRERLNAELDLLASLLPFEQNILSKLDRLSILRLSVSYLRI

Links
Other bHLH family TFs
Other *Anopheles quadriannulatus* TFs