CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

PRUPE_ppa016187mg *(Prunus persica)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00249 (Myb_DNA-binding)	IPR014778	PRUPE_ppa016187mg	T278671_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
KAN2 M07018_2.00	Arabidopsis thaliana	HHHNDWATATTCTYH	DRAGAATATWHNDDD	Dap-seq OMalley et al.(2016) KAN2_col_a	0.909	0.979
KAN2 M07019_2.00	Arabidopsis thaliana	NWWTATTCYYH	DRRGAATAWWN	Dap-seq OMalley et al.(2016) KAN2_colamp_a	0.909	0.979
KAN1 M00878_2.00	Arabidopsis thaliana	NNRTNBNN	NNVNAYNN	PBM Franco-Zorrilla et al.(2014) KAN1	0.875	0.979
KAN1 M02308_2.00	Arabidopsis thaliana	NDNDTAHNHN	NDNDTAHNHN	PBM Weirauch et al.(2014) pTH7135	0.875	0.979
KAN4 M00881_2.00	Arabidopsis thaliana	NWNRTBCNN	NNGVAYNWN	PBM Franco-Zorrilla et al.(2014) KAN4	0.786	0.894
AT1G14600 M01268_2.00	Arabidopsis thaliana	NWAYATTCYN	NRGAATRTWN	PBM Lambert et al.(2019) pTH11557	0.667	0.723
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EMJ12286	Myb	323	374	RMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYR

Links
Other Myb/SANT family TFs
Other *Prunus persica* TFs