CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Bostr.10273s0077 *(Boechera stricta)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00249 (Myb_DNA-binding)	IPR014778	Bostr.10273s0077	T285677_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AT1G72740 M07033_2.00	Arabidopsis thaliana	HMNAAACCCTAAWYY	RRWTTAGGGTTTNKD	Dap-seq OMalley et al.(2016) AT1G72740_col_a	0.824	0.915
AT1G72740 M07034_2.00	Arabidopsis thaliana	HNWAACCCTAAHYHNNNHNNN	NNNDNNNDRDTTAGGGTTWND	Dap-seq OMalley et al.(2016) AT1G72740_colamp_a	0.824	0.915
OS01G0708000 M02326_2.00	Oryza sativa	WRMCCTAVNN	NNBTAGGKYW	PBM Weirauch et al.(2014) pTH8716	0.765	0.745
TRB1 M01070_2.00	Arabidopsis thaliana	WRMCCTAR	YTAGGKYW	PBM Sullivan et al.(2014) pTH7117	0.689	0.681
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bostr.10273s0077.1.p	Myb	5	57	KLKWTGEEEEALLAGIAKHGPGKWKNILRDPDFADQLINRSNIDLKDKWRNLS

Links
Other Myb/SANT family TFs
Other *Boechera stricta* TFs