CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

EURHEDRAFT_400952 *(Aspergillus ruber)* Zinc cluster
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00172 (Zn_clus)	IPR001138	EURHEDRAFT_400952	T366771_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
UPC2 M00920_2.00	Saccharomyces cerevisiae	NTCGTWYVN	NBRWACGAN	PBM Gordan et al.(2011) Upc2	0.558	0.525
UPC2 M07508_2.00	Saccharomyces cerevisiae	NRWACGA	TCGTWYN	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0411.1	0.558	0.525
UPC2 M08654_2.00	Saccharomyces cerevisiae	NRWACGA	TCGTWYN	Misc DeBoer et al.(2011) YDR213W_544	0.558	0.525
For this family, TFs with SR scores > 0.537* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EYE97199	Zinc cluster	14	53	NGCDQCKKRRVKCDEKGPPCSNCTSRQLECTYLKIPRARE

Links
Other Zinc cluster family TFs
Other *Aspergillus ruber* TFs