CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

nLs.2.1.2.g00373 *(Litomosoides sigmodontis)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00046 (Homeobox)	IPR001356	nLs.2.1.2.g00373	T235396_2.00	WormBase:ParaSite (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Six2 M00425_2.00	Mus musculus	NNAYMYNN	NNRKRTNN	PBM Berger et al.(2008) Six2_2307	0.827	0.800
Six1 M00512_2.00	Mus musculus	NNDATMYNNN	NNNRKATHNN	PBM Berger et al.(2008) Six1_0935	0.827	0.800
SIX1 M05094_2.00	Homo sapiens	NNYGATACVB	VBGTATCRNN	SELEX Yin et al.(2017) SIX1_eDBD_HT-SELEX	0.827	0.800
SIX1 M05096_2.00	Homo sapiens	NNYGATAYVB	VBRTATCRNN	SELEX Yin et al.(2017) SIX1_FL_HT-SELEX	0.827	0.800
SIX2 M05285_2.00	Homo sapiens	NNYGATACSB	VSGTATCRNN	SELEX Yin et al.(2017) SIX2_eDBD_HT-SELEX	0.827	0.800
SIX2 M05287_2.00	Homo sapiens	NSGTRWCRYN	NRYGWYACSN	SELEX Yin et al.(2017) SIX2_FL_HT-SELEX	0.827	0.800
SIX1 M08130_2.00	Homo sapiens	GWAACCTGANM	KNTCAGGTTWC	ChIP-seq Mathelier et al.(2014) MA1118.1	0.827	0.800
SIX2 M08133_2.00	Homo sapiens	NNNTGWAACCTGAKMH	DKMTCAGGTTWCANNN	ChIP-seq Mathelier et al.(2014) MA1119.1	0.827	0.800
SIX1 M09142_2.00	Homo sapiens	DGWAAYHTGABMYN	NRKVTCADRTTWCH	Misc Kulakovskiy et al.(2013) SIX1_HUMAN.H11MO.0.A	0.827	0.800
SIX2 M09157_2.00	Homo sapiens	DGWAAYHHGABMH	DKVTCDDRTTWCH	Misc Kulakovskiy et al.(2013) SIX2_HUMAN.H11MO.0.A	0.827	0.800
Six2 M09185_2.00	Mus musculus	DGWAAYHYRABMYB	VRKVTYRDRTTWCH	Misc Kulakovskiy et al.(2013) SIX2_MOUSE.H11MO.0.A	0.827	0.800
Six1 M09579_2.00	Mus musculus	GWAAYHTGABMH	DKVTCADRTTWC	Misc Heinz et al.(2010) Myoblast-Six1_GSE20150	0.827	0.800
SIX1 M10684_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$SIX1_Q3_01	0.827	0.800
SIX1 M10685_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$SIX1_Q3	0.827	0.800
SIX1 M05095_2.00	Homo sapiens	NNYGATABNB	VNVTATCRNN	SELEX Yin et al.(2017) SIX1_eDBD_Methyl-HT-SELEX	0.827	0.800
SIX1 M05097_2.00	Homo sapiens	NNYGATAYSB	VSRTATCRNN	SELEX Yin et al.(2017) SIX1_FL_Methyl-HT-SELEX	0.827	0.800
SIX2 M05286_2.00	Homo sapiens	NBRTATCRNN	NNYGATAYVN	SELEX Yin et al.(2017) SIX2_eDBD_Methyl-HT-SELEX	0.827	0.800
SIX2 M05288_2.00	Homo sapiens	VBRTAWCRNN	NNYGWTAYVB	SELEX Yin et al.(2017) SIX2_FL_Methyl-HT-SELEX	0.827	0.800
so M02117_2.00	Drosophila melanogaster	NDATMYNNN	NNNRKATHN	PBM Weirauch et al.(2014) pTH5690	0.826	0.764
so M03800_2.00	Drosophila melanogaster	NYGATAYB	VRTATCRN	SELEX Nitta et al.(2015) so_1	0.826	0.764
so M03801_2.00	Drosophila melanogaster	YKATAYNNNYGATAY	RTATCRNNNRTATMR	SELEX Nitta et al.(2015) so_2	0.826	0.764
so M03802_2.00	Drosophila melanogaster	YGATACGTATCR	YGATACGTATCR	SELEX Nitta et al.(2015) so_3	0.826	0.764
so M03803_2.00	Drosophila melanogaster	RTATCRYGATAC	GTATCRYGATAY	SELEX Nitta et al.(2015) so_4	0.826	0.764
so M06497_2.00	Drosophila melanogaster	TGATAC	GTATCA	B1H Mathelier et al.(2014) MA0246.1	0.826	0.764
so M06268_2.00	Drosophila melanogaster	NRTGATA	TATCAYN	B1H Zhu et al.(2011) So_Cell_FBgn0003460	0.826	0.764
so M06269_2.00	Drosophila melanogaster	NNNTGATA	TATCANNN	B1H Zhu et al.(2011) So_SOLEXA_FBgn0003460	0.826	0.764
Six4 M00563_2.00	Drosophila melanogaster	NNDANMHNN	NNDKNTHNN	PBM Busser et al.(2012a) Six4	0.706	0.673
Six4 M06530_2.00	Drosophila melanogaster	TGABAC	GTVTCA	B1H Mathelier et al.(2014) MA0204.1	0.706	0.673
Six4 M06334_2.00	Drosophila melanogaster	WDDTGABAC	GTVTCAHHW	B1H Zhu et al.(2011) Six4_Cell_FBgn0027364	0.706	0.673
Six4 M06335_2.00	Drosophila melanogaster	NTGAKACB	VGTMTCAN	B1H Zhu et al.(2011) Six4_SOLEXA_2_FBgn0027364	0.706	0.673
Six4 M06336_2.00	Drosophila melanogaster	NNNTGABA	TVTCANNN	B1H Zhu et al.(2011) Six4_SOLEXA_FBgn0027364	0.706	0.673
Six4 M00461_2.00	Mus musculus	NNKABMHNN	NNDKVTMNN	PBM Berger et al.(2008) Six4_2860	0.706	0.655
SIX4 M04939_2.00	Homo sapiens	NVYGATACVB	VBGTATCRBN	SELEX Yin et al.(2017) SIX4_eDBD_HT-SELEX	0.706	0.655
Six4 M09198_2.00	Mus musculus	DGDAABHNSASNNN	NNNSTSNDVTTHCH	Misc Kulakovskiy et al.(2013) SIX4_MOUSE.H11MO.0.C	0.706	0.655
SIX4 M10646_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$SIX4_Q3	0.706	0.655
SIX4 M04940_2.00	Homo sapiens	NBGTAWCRHN	NDYGWTACVN	SELEX Yin et al.(2017) SIX4_eDBD_Methyl-HT-SELEX	0.706	0.655
SIX5 M08208_2.00	Homo sapiens	GARWTGTAGT	ACTACAWYTC	ChIP-seq Contrino et al.(2012) Mv121	0.706	0.618
SIX5 M08209_2.00	Homo sapiens	GGAGTTGT	ACAACTCC	ChIP-seq Contrino et al.(2012) Mv123	0.706	0.618
SIX5 M10738_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$SIX5_01	0.706	0.618
SIX5 M10739_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$SIX5_02	0.706	0.618
ceh-34 M00672_2.00	Caenorhabditis elegans	NNNRDAWNNN	NNNWTHYNNN	PBM Narasimhan et al.(2015) pTH9708	0.668	0.564
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
nLs.2.1.2.t00373-RA	Homeodomain	133	187	TSYCFREKSRYTLKNWYAKNPYPSPKEKKELAEETHLTVTQVSNWFKNRRQRDRA

Links
Other Homeodomain family TFs
Other *Litomosoides sigmodontis* TFs

539 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
Alligator_sinensis_CCG010046.1	Alligator sinensis	Alligator_sinensis_CCG010046.1	N	0.000
ANCCAN_04327	Ancylostoma caninum	ANCCAN_04327	N	0.000
ANCCEY_00583	Ancylostoma ceylanicum	ANCCEY_00583	N	0.000
ANCDUO_27140	Ancylostoma duodenale	ANCDUO_27140	N	0.000
ANCDUO_17822	Ancylostoma duodenale	ANCDUO_17822	N	0.000
ANCDUO_24135	Ancylostoma duodenale	ANCDUO_24135	N	0.000
AARA011013	Anopheles arabiensis	AARA011013	N	0.000
ACHR009374	Anopheles christyi	ACHR009374	N	0.000
ACUA018702	Anopheles culicifacies	ACUA018702	N	0.000
ACUA008906	Anopheles culicifacies	ACUA008906	N	0.000
AEPI004511	Anopheles epiroticus	AEPI004511	N	0.000
AFUN010567	Anopheles funestus	AFUN010567	N	0.000
AFUN001004	Anopheles funestus	AFUN001004	N	0.000
AMIN000991	Anopheles minimus	AMIN000991	N	0.000
AQUA010449	Anopheles quadriannulatus	AQUA010449	N	0.000
AQUA000257	Anopheles quadriannulatus	AQUA000257	N	0.000
ACEP16128	Atta cephalotes	ACEP16128	N	0.000
ACEP16054	Atta cephalotes	ACEP16054	N	0.000
BGLB011455	Biomphalaria glabrata	BGLB011455	N	0.000
BGIBMGA012898	Bombyx mori	BGIBMGA012898	N	0.000
BGIBMGA006719	Bombyx mori	BGIBMGA006719	N	0.000
BGIBMGA003174	Bombyx mori	BGIBMGA003174	N	0.000
TBX15	Bos taurus	ENSBTAG00000007767	I	0.000
Bm3498	Brugia malayi	Bm3498	I	0.000
Cflo_02417--XP_001121225.1_APIME	Camponotus floridanus	Cflo_02417--XP_001121225.1_APIME	N	0.000
ENSCSAVG00000000786	Ciona savignyi	ENSCSAVG00000000786	I	0.000
KGM_15500	Danaus plexippus	KGM_15500	N	0.000
YQE_06268	Dendroctonus ponderosae	YQE_06268	N	0.000
DICVIV_10715	Dictyocaulus viviparus	DICVIV_10715	N	0.000
DME_0000818901	Dracunculus medinensis	DME_0000818901	N	0.000
GF19461	Drosophila ananassae	FBgn0096470	N	0.000
ECANG7_07880	Echinococcus canadensis	ECANG7_07880	N	0.000
ECPE_0000395601	Echinostoma caproni	ECPE_0000395601	N	0.000
D915_04736	Fasciola hepatica	D915_04736	N	0.000
GPUH_0002190501	Gongylonema pulchrum	GPUH_0002190501	N	0.000
HCOI01136500	Haemonchus contortus	HCOI01136500	N	0.000
HHAL010563-PA	Halyomorpha halys	HHAL010563-PA	N	0.000
Hsal_09269--XP_394607.3_APIME	Harpegnathos saltator	Hsal_09269--XP_394607.3_APIME	N	0.000
HMEL004264	Heliconius melpomene	HMEL004264	N	0.000
NECAME_11635	Necator americanus	NECAME_11635	N	0.000
NECAME_19347	Necator americanus	NECAME_19347	N	0.000
NBR_0002182001	Nippostrongylus brasiliensis	NBR_0002182001	N	0.000
NBR_0000542501	Nippostrongylus brasiliensis	NBR_0000542501	N	0.000
NBR_0001177301	Nippostrongylus brasiliensis	NBR_0001177301	N	0.000
Ocbimv22013221m.g	Octopus bimaculoides	Ocbimv22013221m.g	N	0.000
OESDEN_02780	Oesophagostomum dentatum	OESDEN_02780	N	0.000
OESDEN_07954	Oesophagostomum dentatum	OESDEN_07954	N	0.000
SNAPOd2T00025688001	Oikopleura dioica	SNAPOd2T00025688001	N	0.000
OFLC_0001184101	Onchocerca flexuosa	OFLC_0001184101	N	0.000
nOo.2.0.1.g12774	Onchocerca ochengi	nOo.2.0.1.g12774	N	0.000
nOo.2.0.1.g12879	Onchocerca ochengi	nOo.2.0.1.g12879	N	0.000
ENSOANG00000020395	Ornithorhynchus anatinus	ENSOANG00000020395	I	0.000
ENSOANG00000029773	Ornithorhynchus anatinus	ENSOANG00000029773	I	0.000
PPAI002123	Phlebotomus papatasi	PPAI002123	N	0.000
PPAI007567	Phlebotomus papatasi	PPAI007567	N	0.000
PPA14512	Pristionchus pacificus	PPA14512	N	0.000
PXEA_0000704401	Protopolystoma xenopodis	PXEA_0000704401	N	0.000
PXEA_0001803801	Protopolystoma xenopodis	PXEA_0001803801	N	0.000
Smp_156650	Schistosoma mansoni	Smp_156650	N	0.000
SMTD_0001100101	Schistosoma mattheei	SMTD_0001100101	N	0.000
SMTD_0001779301	Schistosoma mattheei	SMTD_0001779301	N	0.000
SINV20004	Solenopsis invicta	SINV20004	N	0.000
SINV17750	Solenopsis invicta	SINV17750	I	0.000
SPER_0002063901	Spirometra erinaceieuropaei	SPER_0002063901	N	0.000
SPER_0003769001	Spirometra erinaceieuropaei	SPER_0003769001	N	0.000
SPER_0003779701	Spirometra erinaceieuropaei	SPER_0003779701	N	0.000
L596_g4935	Steinernema carpocapsae	L596_g4935	N	0.000
SVUK_0001851801	Strongylus vulgaris	SVUK_0001851801	N	0.000
SMUV_0000075501	Syphacia muris	SMUV_0000075501	N	0.000
TRE_0001207201	Trichobilharzia regenti	TRE_0001207201	N	0.000
Tal_R010698	Tyto alba	Tal_R010698	N	0.000
TBX5	Vicugna pacos	ENSVPAG00000009445	I	0.000
ENSXMAG00000005990	Xiphophorus maculatus	ENSXMAG00000005990	N	0.000
L798_01365	Zootermopsis nevadensis	L798_01365	N	0.000

nLs.2.1.2.g00373 (Litomosoides sigmodontis) Homeodomain

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

539 Related TFs

nLs.2.1.2.g00373 **(Litomosoides sigmodontis)
Homeodomain**