CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

CLUG_01092 *(Candida lusitaniae)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00249 (Myb_DNA-binding)	IPR014778	CLUG_01092	T265660_2.00	Broad (2016-May-1)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
orf19.801 M11058_2.00	Candida albicans	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$TBF1CA_01	0.849	0.913
TBF1 M00065_2.00	Saccharomyces cerevisiae	ARCCCTAN	NTAGGGYT	PBM Badis et al.(2008) TBF1_2078	0.678	0.696
TBF1 M01562_2.00	Saccharomyces cerevisiae	NNWRCCCTRN	NYAGGGYWNN	PBM Zhu et al.(2009) Tbf1	0.678	0.696
TBF1 M07492_2.00	Saccharomyces cerevisiae	WRCCCTAN	NTAGGGYW	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0403.1	0.678	0.696
TBF1 M08597_2.00	Saccharomyces cerevisiae	DHYYAACCCTANBSV	BSVNTAGGGTTRRDH	Misc DeBoer et al.(2011) YPL128C_770	0.678	0.696
TBF1 M11065_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$TBF1_02	0.678	0.696
TBF1 M11066_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$TBF1_03	0.678	0.696
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CLUT_01092	Myb	715	770	RRPWTREEEKALRHALELKGPSWSTILELFGQGGRINESLKNRTQVQLKDKARNWK

Links
Other Myb/SANT family TFs
Other *Candida lusitaniae* TFs