CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

CLUG_05348 *(Clavispora lusitaniae)* RFX
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF02257 (RFX_DNA_binding)	IPR003150	CLUG_05348	T318075_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
RFX1 M00066_2.00	Saccharomyces cerevisiae	NSGTTGCYAN	NTRGCAACSN	PBM Badis et al.(2008) RFX1_4537	0.667	0.443
RFX1 M07494_2.00	Saccharomyces cerevisiae	BGTTRCYA	TRGYAACV	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0365.1	0.667	0.443
RFX1 M08600_2.00	Saccharomyces cerevisiae	CGTYRBYAYRGYWACM	KGTWRCYRTRVYRACG	Misc DeBoer et al.(2011) YLR176C_1478	0.667	0.443
RFX1 M08601_2.00	Saccharomyces cerevisiae	BGTTRCYA	TRGYAACV	Misc DeBoer et al.(2011) YLR176C_496	0.667	0.443
RFX1 M11251_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$RFX1_02	0.667	0.443
For this family, TFs with SR scores > 0.650* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EEQ41220	RFX	167	245	HVFGLVWIQRSCEHAPAAVVPRTRVYARYVQRCADLALHPLAPALFGRLVRVAYPNLTIRRLGVRGKSKYHYCGVRLVD

Links
Other RFX family TFs
Other *Clavispora lusitaniae* TFs