CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Ca_23799 *(Cicer arietinum)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Ca_23799	T006395_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
RAP2-4 M01612_2.00	Arabidopsis thaliana	NRCCGHCMNN	NNKGDCGGYN	PBM Weirauch et al.(2014) pTH8092	0.840	0.920
ERF055 M06577_2.00	Arabidopsis thaliana	NHDYCACCGHCMHH	DDKGDCGGTGRHDN	Dap-seq OMalley et al.(2016) At1g36060_col_a	0.834	0.920
ERF055 M06578_2.00	Arabidopsis thaliana	NHDYCACCGHCMHH	DDKGDCGGTGRHDN	Dap-seq OMalley et al.(2016) At1g36060_colamp_a	0.834	0.920
AT5G65130 M06686_2.00	Arabidopsis thaliana	YCDYCDCCRCCGCCN	NGGCGGYGGHGRHGR	Dap-seq OMalley et al.(2016) At5g65130_col_a	0.723	0.880
AT5G65130 M06687_2.00	Arabidopsis thaliana	NNNNHNNHDSCRCCGMCMW	WKGKCGGYGSHDNNDNNNN	Dap-seq OMalley et al.(2016) At5g65130_colamp_a	0.723	0.880
WIN1 M01603_2.00	Arabidopsis thaliana	VCRCCGCNNN	NNNGCGGYGB	PBM Weirauch et al.(2014) pTH7566	0.690	0.660
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Ca_23799	AP2	168	219	KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFETAEEAALAYDRAAYRLRGD

Links
Other AP2 family TFs
Other *Cicer arietinum* TFs