CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

OBART01G35680 *(Oryza barthii)* LOB
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03195 (DUF260)	IPR004883	OBART01G35680	T245532_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
LBD13 M06956_2.00	Arabidopsis thaliana	YGSCGDNDDHNVCGGHG	CDCCGBNDHHNHCGSCR	Dap-seq OMalley et al.(2016) LBD13_col_a	0.818	0.818
LBD13 M06957_2.00	Arabidopsis thaliana	CGSCGNNDDWNNCGG	CCGNNWHHNNCGSCG	Dap-seq OMalley et al.(2016) LBD13_colamp_a	0.818	0.818
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
OBART01G35680.1	LOB	59	157	PCAACKLLRRRCAQECPFAPYFSPHEPHKFAAVHKVFGASNVSKMLLEVGEAERADAASSLVYEANLRLRDPVYGCMGAISMLQQQVNALEAELEAVRA

Links
Other LOB family TFs
Other *Oryza barthii* TFs