CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GLYMA13G17250 *(Glycine max)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	GLYMA13G17250	T001930_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ERF018 M00842_2.00	Arabidopsis thaliana	HRCCGDCMN	NKGHCGGYD	PBM Franco-Zorrilla et al.(2014) ORA47	0.781	0.860
ERF018 M01610_2.00	Arabidopsis thaliana	NRCCGNCHN	NDGNCGGYN	PBM Weirauch et al.(2014) pTH7215	0.781	0.860
ERF017 M06568_2.00	Arabidopsis thaliana	NHNYCRCCGWCMWH	DWKGWCGGYGRNDN	Dap-seq OMalley et al.(2016) At1g19210_col_a	0.776	0.860
ERF017 M06569_2.00	Arabidopsis thaliana	NNNHNNCRCCGWCMW	WKGWCGGYGNNDNNN	Dap-seq OMalley et al.(2016) At1g19210_colamp_a	0.776	0.860
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GLYMA13G17250.1	AP2	17	68	KYYKGVRKRKWGKWVSEIRLPNSRQRIWLGSFDTPEKAARAFDAAMFCLRGR

Links
Other AP2 family TFs
Other *Glycine max* TFs