CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ORUFI07G11580 *(Oryza rufipogon)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	ORUFI07G11580	T004072_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ERF094 M01602_2.00	Arabidopsis thaliana	VGCCGCCD	HGGCGGCB	PBM Weirauch et al.(2014) pTH8276	0.696	0.694
Q5Y836_TOBAC M09732_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ERF5_02	0.690	0.776
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ORUFI07G11580.1	AP2	74	126	AGFIGVRKRPWGRFAAEIRDSTRNGVRVWLGTFETAEAAAMAYDQAALSARGA

Links
Other AP2 family TFs
Other *Oryza rufipogon* TFs