CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Carubv10010259m.g *(Capsella rubella)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Carubv10010259m.g	T007850_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ERF014 M06581_2.00	Arabidopsis thaliana	YCDYCDCCACCGHCD	HGDCGGTGGHGRHGR	Dap-seq OMalley et al.(2016) AT1G44830_col_a	0.796	1.000
ERF012 M06570_2.00	Arabidopsis thaliana	NHNNHNHHDHHDCCACCGHC	GDCGGTGGHDDHDDNDNNDN	Dap-seq OMalley et al.(2016) DREB26_col_a	0.782	0.960
ERF013 M06601_2.00	Arabidopsis thaliana	DYCACCGHCAHHDNHNNNNNN	NNNNNNDNHDDTGDCGGTGRH	Dap-seq OMalley et al.(2016) At1g77640_col_a	0.763	0.960
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Carubv10010259m	AP2	37	88	KKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYSTAEAAARAYDAALLCLKGS

Links
Other AP2 family TFs
Other *Capsella rubella* TFs