CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ENSFALG00000003827 *(Ficedula albicollis)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	ENSFALG00000003827	T034103_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Npas2 M01731_2.00	Mus musculus	NVCACGTGBN	NVCACGTGBN	PBM Weirauch et al.(2014) pTH5457	0.914	1.000
NPAS2 M04158_2.00	Homo sapiens	NRCACGTGKH	DMCACGTGYN	SELEX Yin et al.(2017) NPAS2_eDBD_HT-SELEX	0.914	1.000
Npas2 M09468_2.00	Mus musculus	VKCACRTGKM	KMCAYGTGMB	Misc Heinz et al.(2010) Liver-NPAS2_GSE39860	0.914	1.000
NPAS2 M04159_2.00	Homo sapiens	DVCRCRTGKH	DMCAYGYGBH	SELEX Yin et al.(2017) NPAS2_eDBD_Methyl-HT-SELEX	0.914	1.000
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSFALP00000004010	bHLH	10	59	KRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKH

Links
Other bHLH family TFs
Other *Ficedula albicollis* TFs