CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Cflo_02744--XP_394233.3_APIME *(Camponotus floridanus)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00010 (HLH)	IPR001092	Cflo_02744--XP_394233.3_APIME	T046881_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Clk M05972_2.00	Drosophila melanogaster	MCACGTGV	BCACGTGK	B1H Zhu et al.(2011) Clk_cyc_SANGER_5_FBgn0023076	0.864	0.820
Clk M05973_2.00	Drosophila melanogaster	CACGTGSY	RSCACGTG	B1H Zhu et al.(2011) gce_Clk_SANGER_5_FBgn0023076	0.864	0.820
Clk M05974_2.00	Drosophila melanogaster	CACGTGKM	KACACGTG	B1H Zhu et al.(2011) Met_Clk_SANGER_5_FBgn0023076	0.864	0.820
Clk M05975_2.00	Drosophila melanogaster	SACACGTGY	RCACGTGTS	B1H Zhu et al.(2011) tai_Clk_SANGER_5_FBgn0023076	0.864	0.820
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Cflo_02744--XP_394233.3_APIME	bHLH	12	61	KRKSRNLSEKKRRDQFNMLVNELGSMISANTRKMDKSTVLKSTILFLKNH

Links
Other bHLH family TFs
Other *Camponotus floridanus* TFs