CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

OBART07G26390 *(Oryza barthii)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	OBART07G26390	T065412_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PK00315.1 M01153_2.00	Cannabis sativa	NNGACAGCTRN	NYAGCTGTCNN	PBM Lambert et al.(2019) pTH10085	0.846	0.984
PK16335.1 M01157_2.00	Cannabis sativa	NNNNKACAGCTRN	NYAGCTGTMNNNN	PBM Lambert et al.(2019) pTH10187	0.846	0.967
AtbZIP52 M06746_2.00	Arabidopsis thaliana	DTGMCAGCYBDNHH	DDNHVRGCTGKCAH	Dap-seq OMalley et al.(2016) bZIP52_colamp_a	0.832	0.902
AtbZIP52 M06747_2.00	Arabidopsis thaliana	DTGMCAGCYKDNHN	NDNHMRGCTGKCAH	Dap-seq OMalley et al.(2016) bZIP52_col_v31	0.832	0.902
BZIP18 M01777_2.00	Arabidopsis thaliana	NDMCARNHNN	NNDNYTGKHN	PBM Weirauch et al.(2014) pTH7316	0.831	0.934
BZIP18 M06768_2.00	Arabidopsis thaliana	DTGMCAGCTDD	HHAGCTGKCAH	Dap-seq OMalley et al.(2016) bZIP18_colamp_a	0.831	0.934
BZIP18 M06769_2.00	Arabidopsis thaliana	TGMCAGCTKKN	NMMAGCTGKCA	Dap-seq OMalley et al.(2016) bZIP18_col_v31	0.831	0.934
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
OBART07G26390.1	bZIP	79	139	DPKRAKRILANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLFQRDTTGLSAEN

Links
Other bZIP family TFs
Other *Oryza barthii* TFs