CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

LLOJ006051 *(Lutzomyia longipalpis)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00170 (bZIP_1)	IPR011616	LLOJ006051	T073958_2.00	Vectorbase (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
slbo M03642_2.00	Drosophila melanogaster	NRTTRCGYAAYN	NRTTRCGYAAYN	SELEX Nitta et al.(2015) slbo_1	0.842	0.852
slbo M03643_2.00	Drosophila melanogaster	NRTTRCGYAAYN	NRTTRCGYAAYN	SELEX Nitta et al.(2015) slbo_2	0.842	0.852
slbo M06021_2.00	Drosophila melanogaster	ATTRCVMA	TKBGYAAT	B1H Zhu et al.(2011) slbo_FlyReg_FBgn0005638	0.842	0.852
slbo M06022_2.00	Drosophila melanogaster	DRTKWCGYAAB	VTTRCGWMAYH	B1H Zhu et al.(2011) slbo_SANGER_5_FBgn0005638	0.842	0.852
slbo M07540_2.00	Drosophila melanogaster	ATTRCVMA	TKBGYAAT	DNaseI footprinting Mathelier et al.(2014) MA0244.1	0.842	0.852
slbo M10035_2.00	Drosophila melanogaster	Transfac license required	Transfac license required	Transfac Matys et al.(2006) I$CEBP_Q6	0.842	0.852
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
LLOJ006051-PA	bZIP	294	354	DEYRRRRERNNIAVRKSREKAKVRSREVEEKVKTLIKEKEVLIRRLEEMTNEIQLHKQLYM

Links
Other bZIP family TFs
Other *Lutzomyia longipalpis* TFs