CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ACOM023689 *(Anopheles coluzzii)* CxxC
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF02008 (zf-CXXC)	IPR002857	ACOM023689	T168732_2.00	Vectorbase (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
BGIBMGA012843 M01907_2.00	Bombyx mori	NNCGCGTANVNN	NNBNTACGCGNN	PBM Weirauch et al.(2014) pTH9239	0.851	0.851
kdm2ba M01909_2.00	Danio rerio	NNNNCGN	NCGNNNN	PBM Weirauch et al.(2014) pTH8577	0.745	0.745
KDM2B M01911_2.00	Homo sapiens	NNNNNNCGN	NCGNNNNNN	PBM Weirauch et al.(2014) pTH9191	0.745	0.745
A6H8I1_DANRE M01906_2.00	Danio rerio	CGTACGYA	TRCGTACG	PBM Weirauch et al.(2014) pTH9257	0.702	0.702
FBXL19 M01916_2.00	Tetraodon nigroviridis	NNNNCGNN	NNCGNNNN	PBM Weirauch et al.(2014) pTH8570	0.702	0.702
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ACOM023689-PA	CxxC	564	610	GPRRRRTRCKNCEACQRSDCGECSFCLDMVKFGGPGRAKQTCMMRQC

Links
Other CxxC family TFs
Other *Anopheles coluzzii* TFs