CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Solyc01g096810.2 *(Solanum lycopersicum)* EIN3
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF04873 (EIN3)	IPR006957	Solyc01g096810.2	T175241_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Q9ZWK1_TOBAC M10470_2.00	Nicotiana tabacum	AGRTWCAT	ATGWAYCT	Transfac Matys et al.(2006) P$TEIL_01	0.866	0.866
EIN3 M00725_2.00	Arabidopsis thaliana	NNRTDHAYNN	NNRTDHAYNN	PBM Chang et al.(2013) pTH8729	0.854	0.854
EIN3 M06878_2.00	Arabidopsis thaliana	GDMYANRTWCAWTGH	DCAWTGWAYNTRKHC	Dap-seq OMalley et al.(2016) EIN3_col_a	0.854	0.854
EIN3 M06879_2.00	Arabidopsis thaliana	RCCGTTR	YAACGGY	Dap-seq OMalley et al.(2016) EIN3_colamp_a	0.854	0.854
EIL1 M00724_2.00	Arabidopsis thaliana	NNVRTDMRN	NYKHAYBNN	PBM Chang et al.(2013) pTH7932	0.846	0.846
e_gw1.87.73.1 M00726_2.00	Physcomitrella patens	NNNRTDCDBN	NVHGHAYNNN	PBM Chang et al.(2013) pTH8479	0.813	0.813
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Solyc01g096810.2.1	EIN3	47	294	EELERRMWRDRMLLRRLKEKNKNKVVGDGAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCNAQGFVYGIIPEKGKPVTGASDNLRAWWKEKVRFDRNGPAAIAKYQADNQIPGRVEESSVIVSTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPSGKEEWWGQLGLPNDQVQPPYKKPHDLKKAWKVGVLTAVIKHISPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEE

Links
Other EIN3 family TFs
Other *Solanum lycopersicum* TFs