CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

CANTEDRAFT_113880 *(Candida tenuis)* GATA
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00320 (GATA)	IPR000679	CANTEDRAFT_113880	T192089_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
nit-2 M02017_2.00	Neurospora crassa	NNGATHNN	NNDATCNN	PBM Weirauch et al.(2014) pTH8624	0.851	0.914
nit-2 M10601_2.00	Neurospora crassa	DHGATA	TATCDH	Transfac Matys et al.(2006) F$NIT2_01	0.851	0.914
GATAe M03761_2.00	Drosophila melanogaster	VHGATAAS	STTATCDB	SELEX Nitta et al.(2015) GATAe_1	0.833	0.629
GATAe M03762_2.00	Drosophila melanogaster	HGATAACNNNGTTATCD	HGATAACNNNGTTATCD	SELEX Nitta et al.(2015) GATAe_2	0.833	0.629
GATAe M03763_2.00	Drosophila melanogaster	HGATAAGNNNCTTATCD	HGATAAGNNNCTTATCD	SELEX Nitta et al.(2015) GATAe_3	0.833	0.629
GATAe M06208_2.00	Drosophila melanogaster	WGATAAG	CTTATCW	B1H Zhu et al.(2011) GATAe_SANGER_5_FBgn0038391	0.833	0.629
For this family, TFs with SR scores > 0.802* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EGV63851	GATA	384	418	CTNCHTKTTPLWRRNPEGQPLCNACGLFLKLHGVV

Links
Other GATA family TFs
Other *Candida tenuis* TFs