CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

13027_YKL185W *(Saccharomyces mikatae)* GATA
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00320 (GATA)	IPR000679	13027_YKL185W	T196999_2.00	Superfamily (2010-Oct-26)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ASH1 M08419_2.00	Saccharomyces cerevisiae	CCYGAYBYGG	CCRVRTCRGG	ChIP-chip Mathelier et al.(2014) MA0276.1	0.867	0.972
ASH1 M08563_2.00	Saccharomyces cerevisiae	YTGAT	ATCAR	Misc DeBoer et al.(2011) YKL185W_28	0.867	0.972
ASH1 M10599_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$ASH1_01	0.867	0.972
For this family, TFs with SR scores > 0.802* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
13027_YKL185W	GATA	501	538	CVSCNSSDSPCWRPSWSPRKQDQLCNSCGLRYKKTHTR

Links
Other GATA family TFs
Other *Saccharomyces mikatae* TFs