CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ENSPFOG00000005824 *(Poecilia formosa)* MADF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF10545 (MADF_DNA_bdg)	IPR006578	ENSPFOG00000005824	T248386_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
naif1.S M02282_2.00	Xenopus laevis	NNDRCGTAN	NTACGYHNN	PBM Weirauch et al.(2014) pTH9299	0.888	0.455
naif1 M02281_2.00	Xenopus tropicalis	NNNCGYANN	NNTRCGNNN	PBM Weirauch et al.(2014) pTH8560	0.886	0.429
NAIF1_CHICK M01260_2.00	Gallus gallus	NNNDRCGTAN	NTACGYHNNN	PBM Lambert et al.(2019) pTH9808	0.886	0.442
For this family, TFs with SR scores > 0.812* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSPFOP00000005700	MADF	22	103	EEIEKQKQTLVSHFNAGVTHMAKNNAWMDILKKVNAVTTCPRELPEVKKKWSDMKTEVRRKVAQARAAIEGTAADCAPVPVI

Links
Other MADF family TFs
Other *Poecilia formosa* TFs