CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Bo2g134900 *(Brassica oleracea)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00249 (Myb_DNA-binding)	IPR014778	Bo2g134900	T267177_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AT1G14600 M01268_2.00	Arabidopsis thaliana	NWAYATTCYN	NRGAATRTWN	PBM Lambert et al.(2019) pTH11557	0.775	0.872
PK26523.1 M01283_2.00	Cannabis sativa	NWHATTCYNN	NNRGAATDWN	PBM Lambert et al.(2019) pTH11304	0.715	0.787
AT2G40260 M07057_2.00	Arabidopsis thaliana	HHWDWAHATTCYHTN	NADRGAATDTWHWDD	Dap-seq OMalley et al.(2016) AT2G40260_col_a	0.694	0.723
AT2G40260 M07058_2.00	Arabidopsis thaliana	NNDDWHHNDDWAHATTCYHT	ADRGAATDTWHHNDDWHHNN	Dap-seq OMalley et al.(2016) AT2G40260_colamp_a	0.694	0.723
AT2G38300 M07056_2.00	Arabidopsis thaliana	WAHATTCYHTH	DADRGAATDTW	Dap-seq OMalley et al.(2016) AT2G38300_col_a	0.674	0.766
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bo2g134900.1	Myb	36	87	RLRWTPDLHRCFVNAVDMLGGQHRATPKLVLKMMDVKGLTISHVKSHLQMHR

Links
Other Myb/SANT family TFs
Other *Brassica oleracea* TFs