CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Bra036035 *(Brassica rapa)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00249 (Myb_DNA-binding)	IPR014778	Bra036035	T268108_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
TRB2 M02314_2.00	Arabidopsis thaliana	WRMCCTAR	YTAGGKYW	PBM Weirauch et al.(2014) pTH7094	0.664	0.638
TRB2 M01083_2.00	Arabidopsis thaliana	HRMCCTAR	YTAGGKYD	PBM Sullivan et al.(2014) pTH7260	0.664	0.638
TRB2 M07157_2.00	Arabidopsis thaliana	HHHHHNWWRCCCTAAWHHN	NDDWTTAGGGYWWNDDDDD	Dap-seq OMalley et al.(2016) TBP3_col_a	0.664	0.638
TRB2 M07158_2.00	Arabidopsis thaliana	HVDHHHNWARCCCTAAHYH	DRDTTAGGGYTWNDDDHBD	Dap-seq OMalley et al.(2016) TBP3_colamp_a	0.664	0.638
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bra036035.1-P	Myb	5	57	KKMWTPKEVTALRDGVRKYGSGKWSGILSDSKYGRALKARSNVDLKDKWRNLG

Links
Other Myb/SANT family TFs
Other *Brassica rapa* TFs