CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Bostr.13129s0456 *(Boechera stricta)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00249 (Myb_DNA-binding)	IPR014778	Bostr.13129s0456	T285701_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AT5G05090 M02305_2.00	Arabidopsis thaliana	NHAGATHCKNN	NNMGDATCTDN	PBM Weirauch et al.(2014) pTH7104	0.909	1.000
e_gw1.362.4.1 M02341_2.00	Physcomitrella patens	NNNRDATCNN	NNGATHYNNN	PBM Weirauch et al.(2014) pTH8461	0.675	0.702
estExt_fgenesh1_pg.C_Chr_16.00010090 M02367_2.00	Ostreococcus tauri	NNNDATCN	NGATHNNN	PBM Weirauch et al.(2014) pTH9644	0.675	0.702
ARR14 M00873_2.00	Arabidopsis thaliana	NNAGATHCKS	SMGDATCTNN	PBM Franco-Zorrilla et al.(2014) ARR14	0.666	0.660
ARR14 M02293_2.00	Arabidopsis thaliana	NAGATHYBNN	NNVRDATCTN	PBM Weirauch et al.(2014) pTH7531	0.666	0.660
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bostr.13129s0456.1.p	Myb	84	134	RLVWTPQLHKRFVDAVAHLGIKNAVPKTIMQLMSVDGLTRENVASHLQKYR

Links
Other Myb/SANT family TFs
Other *Boechera stricta* TFs