CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

TEQG_03791 *(Trichophyton equinum)* Sox
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00505 (HMG_box)	IPR000910	TEQG_03791	T332847_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ROX1 M00070_2.00	Saccharomyces cerevisiae	NRAACAATWNN	NNWATTGTTYN	PBM Badis et al.(2008) ROX1_2099	0.425	0.471
ROX1 M07498_2.00	Saccharomyces cerevisiae	YYHATTGTTYTS	SARAACAATDRR	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0371.1	0.425	0.471
ROX1 M08607_2.00	Saccharomyces cerevisiae	BYATTGTN	NACAATRV	Misc DeBoer et al.(2011) YPR065W_1396	0.425	0.471
ROX1 M11346_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$ROX1_Q6_01	0.425	0.471
ROX1 M11347_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$ROX1_Q6	0.425	0.471
For this family, TFs with SR scores > 0.415* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EGE04946	Sox	152	219	IPRPRNAFILFRQHLQSSVVAENPGLPNPDISKIIGKIWKGLPLKEQEPWKKHADEEKARHLQKYQAT

Links
Other Sox family TFs
Other *Trichophyton equinum* TFs