CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Pvit_02386 *(Pogona vitticeps)* THAP finger
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF05485 (THAP)	IPR006612	Pvit_02386	T349416_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
THAP12 M02539_2.00	Gallus gallus	NBNYCKGKMNNN	NNNKMCMGRNVN	PBM Weirauch et al.(2014) pTH8688	0.931	0.931
THAP12 M02538_2.00	Homo sapiens	NNNYMBNNBGRN	NYCVNNVKRNNN	PBM Weirauch et al.(2014) pTH9190	0.879	0.879
prkrirb M02536_2.00	Danio rerio	NNMCMGMSGGNN	NNCCSKCKGKNN	PBM Weirauch et al.(2014) pTH8319	0.776	0.776
prkrirb M02540_2.00	Oryzias latipes	NNBBCCGGNHN	NDNCCGGVVNN	PBM Weirauch et al.(2014) pTH9383	0.707	0.707
prkrirb M02541_2.00	Tetraodon nigroviridis	CCCGCGGG	CCCGCGGG	PBM Weirauch et al.(2014) pTH8574	0.707	0.707
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Pvit_02386	THAP finger	3	65	SVSCRCQRWVENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRSSPYRTVLRDNAVPTIFDL

Links
Other THAP finger family TFs
Other *Pogona vitticeps* TFs