CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GLYMA06G14731 *(Glycine max)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03106 (WRKY)	IPR003657	GLYMA06G14731	T352661_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY55 M07392_2.00	Arabidopsis thaliana	HWAGTCAACGNH	DNCGTTGACTWD	Dap-seq OMalley et al.(2016) WRKY55_col_a	0.859	0.763
WRKY53 M01090_2.00	Arabidopsis thaliana	RGTCAACNN	NNGTTGACY	PBM Sullivan et al.(2014) pTH8245	0.832	0.695
WRKY70 M07399_2.00	Arabidopsis thaliana	HAAAGTCAACGNN	NNCGTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY70_col	0.830	0.627
WRKY30 M02563_2.00	Arabidopsis thaliana	RGTCAACNNN	NNNGTTGACY	PBM Weirauch et al.(2014) pTH7611	0.829	0.644
WRKY30 M07422_2.00	Arabidopsis thaliana	DAAGTCAACGN	NCGTTGACTTH	Dap-seq OMalley et al.(2016) WRKY30_col_a	0.829	0.644
WRKY30 M07423_2.00	Arabidopsis thaliana	NNAAGTCAACGNH	DNCGTTGACTTNN	Dap-seq OMalley et al.(2016) WRKY30_colamp_a	0.829	0.644
WRKY62 M02561_2.00	Arabidopsis thaliana	TRGTCAAM	KTTGACYA	PBM Weirauch et al.(2014) pTH8246	0.821	0.542
WRKY46 M07395_2.00	Arabidopsis thaliana	VAAAGTCAAMG	CKTTGACTTTB	Dap-seq OMalley et al.(2016) WRKY46_col_a	0.813	0.644
WRKY46 M07396_2.00	Arabidopsis thaliana	HRAAGTCAACG	CGTTGACTTYD	Dap-seq OMalley et al.(2016) WRKY46_colamp_a	0.813	0.644
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GLYMA06G14731.1	WRKY	174	234	EDGFTWRKYGQKEILGSKFPRSYYRCTHQKLYECQAKKQVQRLDQNPNIFEVTYRGDHTCH
GLYMA06G14731.2	WRKY	172	232	EDGFTWRKYGQKEILGSKFPRSYYRCTHQKLYECQAKKQVQRLDQNPNIFEVTYRGDHTCH

Links
Other WRKY family TFs
Other *Glycine max* TFs

479 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
COCC4DRAFT_64047	Bipolaris maydis	COCC4DRAFT_64047	N
COCCADRAFT_24941	Bipolaris zeicola	COCCADRAFT_24941	N
COCSADRAFT_162023	Bipolaris sorokiniana	COCSADRAFT_162023	N
COCVIDRAFT_95073	Bipolaris victoriae	COCVIDRAFT_95073	N
fgenesh1_pg.C_scaffold_21000149	Cochliobolus heterostrophus C5	fgenesh1_pg.C_scaffold_21000149	N