CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GRMZM2G408462 *(Zea mays)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03106 (WRKY)	IPR003657	GRMZM2G408462	T352884_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY53 M01090_2.00	Arabidopsis thaliana	RGTCAACNN	NNGTTGACY	PBM Sullivan et al.(2014) pTH8245	0.842	0.712
WRKY30 M02563_2.00	Arabidopsis thaliana	RGTCAACNNN	NNNGTTGACY	PBM Weirauch et al.(2014) pTH7611	0.825	0.627
WRKY30 M07422_2.00	Arabidopsis thaliana	DAAGTCAACGN	NCGTTGACTTH	Dap-seq OMalley et al.(2016) WRKY30_col_a	0.825	0.627
WRKY30 M07423_2.00	Arabidopsis thaliana	NNAAGTCAACGNH	DNCGTTGACTTNN	Dap-seq OMalley et al.(2016) WRKY30_colamp_a	0.825	0.627
WRKY70 M07399_2.00	Arabidopsis thaliana	HAAAGTCAACGNN	NNCGTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY70_col	0.823	0.576
WRKY55 M07392_2.00	Arabidopsis thaliana	HWAGTCAACGNH	DNCGTTGACTWD	Dap-seq OMalley et al.(2016) WRKY55_col_a	0.819	0.627
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GRMZM2G408462_P01	WRKY	130	190	DDGLSWRKYGQKDILGAKYPRAYFRCTHRHTQSCQASKQVQRTDGDPLLFDVVYHGTHTCA

Links
Other WRKY family TFs
Other *Zea mays* TFs

469 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action