CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Traes_5DL_5C93510D5 *(Triticum aestivum)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03106 (WRKY)	IPR003657	Traes_5DL_5C93510D5	T355024_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY30 M02563_2.00	Arabidopsis thaliana	RGTCAACNNN	NNNGTTGACY	PBM Weirauch et al.(2014) pTH7611	0.833	0.695
WRKY30 M07422_2.00	Arabidopsis thaliana	DAAGTCAACGN	NCGTTGACTTH	Dap-seq OMalley et al.(2016) WRKY30_col_a	0.833	0.695
WRKY30 M07423_2.00	Arabidopsis thaliana	NNAAGTCAACGNH	DNCGTTGACTTNN	Dap-seq OMalley et al.(2016) WRKY30_colamp_a	0.833	0.695
WRKY53 M01090_2.00	Arabidopsis thaliana	RGTCAACNN	NNGTTGACY	PBM Sullivan et al.(2014) pTH8245	0.826	0.661
WRKY55 M07392_2.00	Arabidopsis thaliana	HWAGTCAACGNH	DNCGTTGACTWD	Dap-seq OMalley et al.(2016) WRKY55_col_a	0.822	0.661
WRKY11 M02559_2.00	Arabidopsis thaliana	NDGTCAAHNN	NNDTTGACHN	PBM Weirauch et al.(2014) pTH8091	0.809	0.559
WRKY11 M07415_2.00	Arabidopsis thaliana	NHAAAGTCAACBNH	DNVGTTGACTTTDN	Dap-seq OMalley et al.(2016) WRKY11_col_a	0.809	0.559
WRKY11 M11464_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$WRKY11_Q2	0.809	0.559
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Traes_5DL_5C93510D5.1	WRKY	125	185	DDGRSWRKYGQKDILGAQHPRAYYRCTYQKTQGCAATKQVQRADEDPALFDVIYHGEHTCV

Links
Other WRKY family TFs
Other *Triticum aestivum* TFs

543 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action