CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Ca_08975 *(Cicer arietinum)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03106 (WRKY)	IPR003657	Ca_08975	T355235_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Q40090_IPOBA M11466_2.00	Ipomoea batatas	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$SPF1_Q2	0.875	0.905
WRKY33 M02554_2.00	Arabidopsis thaliana	NNRGTCHDNN	NNHDGACYNN	PBM Weirauch et al.(2014) pTH8183	0.874	0.888
WRKY33 M07391_2.00	Arabidopsis thaliana	HWWAGTCAAMD	HKTTGACTWWD	Dap-seq OMalley et al.(2016) WRKY33_col_a	0.874	0.888
WRKY26 M07418_2.00	Arabidopsis thaliana	MWAAGTCAACGNH	DNCGTTGACTWWK	Dap-seq OMalley et al.(2016) WRKY26_col_a	0.867	0.836
WRKY26 M07419_2.00	Arabidopsis thaliana	HMWAGTCAAMR	YKTTGACTWKD	Dap-seq OMalley et al.(2016) WRKY26_colamp_a	0.867	0.836
WRKY3 M07381_2.00	Arabidopsis thaliana	MAWAGTCAAMR	YKTTGACTWTK	Dap-seq OMalley et al.(2016) WRKY3_col_a	0.861	0.810
WRKY25 M02552_2.00	Arabidopsis thaliana	YRGTCAAM	KTTGACYR	PBM Weirauch et al.(2014) pTH8810	0.860	0.759
WRKY25 M07387_2.00	Arabidopsis thaliana	HWWRGTCAAMR	YKTTGACYWWD	Dap-seq OMalley et al.(2016) WRKY25_col_a	0.860	0.759
WRKY25 M07388_2.00	Arabidopsis thaliana	NNNHWRGTCAACRNH	DNYGTTGACYWDNNN	Dap-seq OMalley et al.(2016) WRKY25_colamp_a	0.860	0.759
WRKY20 M07414_2.00	Arabidopsis thaliana	HHHRGTCAAMGNH	DNCKTTGACYDDD	Dap-seq OMalley et al.(2016) WRKY20_col_a	0.858	0.810
PK05432.1 M01324_2.00	Cannabis sativa	NNRGTCARH	DYTGACYNN	PBM Lambert et al.(2019) pTH11342	0.856	0.836
WRKY2 M02567_2.00	Arabidopsis thaliana	BRGTCAAM	KTTGACYV	PBM Weirauch et al.(2014) pTH8832	0.856	0.828
ZAP1 M02726_2.00	Arabidopsis thaliana	DRCKCGGTCAA	TTGACCGMGYH	SELEX Mathelier et al.(2014) MA0589.1	0.836	0.664
ZAP1 M11463_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ZAP1_01	0.836	0.664
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Ca_08975	WRKY	198	255	DDGYNWRKYGQKQVKGSENPRSYYKCTYPNCPTKKKVEKRSLDGQITEIVYKGNHNHP
Ca_08975	WRKY	357	414	DDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCPVRKHVERASQDLRAVITTYEGKHNHD

Links
Other WRKY family TFs
Other *Cicer arietinum* TFs

797 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

Ca_08975 (Cicer arietinum) WRKY

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

797 Related TFs

Ca_08975 **(Cicer arietinum)
WRKY**