CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Cla018303 *(Citrullus lanatus)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03106 (WRKY)	IPR003657	Cla018303	T355310_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY33 M02554_2.00	Arabidopsis thaliana	NNRGTCHDNN	NNHDGACYNN	PBM Weirauch et al.(2014) pTH8183	0.875	0.896
WRKY33 M07391_2.00	Arabidopsis thaliana	HWWAGTCAAMD	HKTTGACTWWD	Dap-seq OMalley et al.(2016) WRKY33_col_a	0.875	0.896
Q40090_IPOBA M11466_2.00	Ipomoea batatas	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$SPF1_Q2	0.871	0.878
WRKY26 M07418_2.00	Arabidopsis thaliana	MWAAGTCAACGNH	DNCGTTGACTWWK	Dap-seq OMalley et al.(2016) WRKY26_col_a	0.868	0.809
WRKY26 M07419_2.00	Arabidopsis thaliana	HMWAGTCAAMR	YKTTGACTWKD	Dap-seq OMalley et al.(2016) WRKY26_colamp_a	0.868	0.809
WRKY3 M07381_2.00	Arabidopsis thaliana	MAWAGTCAAMR	YKTTGACTWTK	Dap-seq OMalley et al.(2016) WRKY3_col_a	0.857	0.809
PK05432.1 M01324_2.00	Cannabis sativa	NNRGTCARH	DYTGACYNN	PBM Lambert et al.(2019) pTH11342	0.857	0.809
WRKY20 M07414_2.00	Arabidopsis thaliana	HHHRGTCAAMGNH	DNCKTTGACYDDD	Dap-seq OMalley et al.(2016) WRKY20_col_a	0.855	0.774
WRKY2 M02567_2.00	Arabidopsis thaliana	BRGTCAAM	KTTGACYV	PBM Weirauch et al.(2014) pTH8832	0.855	0.791
WRKY25 M02552_2.00	Arabidopsis thaliana	YRGTCAAM	KTTGACYR	PBM Weirauch et al.(2014) pTH8810	0.854	0.748
WRKY25 M07387_2.00	Arabidopsis thaliana	HWWRGTCAAMR	YKTTGACYWWD	Dap-seq OMalley et al.(2016) WRKY25_col_a	0.854	0.748
WRKY25 M07388_2.00	Arabidopsis thaliana	NNNHWRGTCAACRNH	DNYGTTGACYWDNNN	Dap-seq OMalley et al.(2016) WRKY25_colamp_a	0.854	0.748
ZAP1 M02726_2.00	Arabidopsis thaliana	DRCKCGGTCAA	TTGACCGMGYH	SELEX Mathelier et al.(2014) MA0589.1	0.827	0.643
ZAP1 M11463_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ZAP1_01	0.827	0.643
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Cla018303	WRKY	170	226	NDGYNWRKYGQKQVKGSENPRSYYKCTFPSCPTKKKVERSLDGQITEIVYKGSHNHA
Cla018303	WRKY	319	376	PDGYRWRKYGQKVVKGNPNPRSYYKCTSLGCPVRKHIERAANDMRAVITTYEGKHNHE

Links
Other WRKY family TFs
Other *Citrullus lanatus* TFs

794 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

Cla018303 (Citrullus lanatus) WRKY

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

794 Related TFs

Cla018303 **(Citrullus lanatus)
WRKY**