CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

AACERI_AaceriABL099W *(Saccharomycetaceae sp ashbya aceri)* Zinc cluster
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00172 (Zn_clus)	IPR001138	AACERI_AaceriABL099W	T359143_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
LYS14 M00080_2.00	Saccharomyces cerevisiae	NNNNGVDWHN	NDWHBCNNNN	PBM Badis et al.(2008) LYS14_2065	0.549	0.800
LYS14 M01574_2.00	Saccharomyces cerevisiae	NNGGRAWNN	NNWTYCCNN	PBM Zhu et al.(2009) Lys14	0.549	0.800
LYS14 M07507_2.00	Saccharomyces cerevisiae	VCGGAATT	AATTCCGB	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0325.1	0.549	0.800
LYS14 M08651_2.00	Saccharomyces cerevisiae	WWTTCCRVYGGRAWH	DWTYCCRBYGGAAWW	Misc DeBoer et al.(2011) YDR034C_133	0.549	0.800
LYS14 M08652_2.00	Saccharomyces cerevisiae	DNNVHVCGGAATTTNKNNNN	NNNNMNAAATTCCGBDBNNH	Misc DeBoer et al.(2011) YDR034C_865	0.549	0.800
For this family, TFs with SR scores > 0.537* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
AGO10356	Zinc cluster	195	234	NGCTECKRRRMKCDEGKPICWQCSRLNRECNYILNAKNKK

Links
Other Zinc cluster family TFs
Other *Saccharomycetaceae sp ashbya aceri* TFs