CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

NDAI_0F02030 *(Naumovozyma dairenensis)* Zinc cluster
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00172 (Zn_clus)	IPR001138	NDAI_0F02030	T375444_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ERT1 M00077_2.00	Saccharomyces cerevisiae	NYCGGAAY	RTTCCGRN	PBM Badis et al.(2008) YBR239C_2158	0.577	0.795
ERT1 M01572_2.00	Saccharomyces cerevisiae	NNCGGARNN	NNYTCCGNN	PBM Zhu et al.(2009) Ybr239c	0.577	0.795
ERT1 M07504_2.00	Saccharomyces cerevisiae	DYCGGAAY	RTTCCGRH	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0420.1	0.577	0.795
ERT1 M08646_2.00	Saccharomyces cerevisiae	DYCGGAAY	RTTCCGRH	Misc DeBoer et al.(2011) YBR239C_564	0.577	0.795
For this family, TFs with SR scores > 0.537* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CCD25521	Zinc cluster	58	98	VACINCSKWHVSCEAQRPCSRCIKKGLKDTCIDAPRKKSKY

Links
Other Zinc cluster family TFs
Other *Naumovozyma dairenensis* TFs