CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

PAS_FragB_0075 *(Komagataella pastoris)* Zinc cluster
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00172 (Zn_clus)	IPR001138	PAS_FragB_0075	T376945_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
GAL4 M01599_2.00	Saccharomyces cerevisiae	NYCGGVN	NBCCGRN	PBM Zhu et al.(2009) Gal4	0.540	0.641
GAL4 M07559_2.00	Saccharomyces cerevisiae	GGANVRCW	WGYBNTCC	ChIP-exo Rhee et al.(2011) Gal4_1	0.540	0.641
GAL4 M07560_2.00	Saccharomyces cerevisiae	GGRAAARGGTC	GACCYTTTYCC	ChIP-exo Rhee et al.(2011) Gal4_2	0.540	0.641
GAL4 M07561_2.00	Saccharomyces cerevisiae	AGAACAA	TTGTTCT	ChIP-exo Rhee et al.(2011) Gal4_3	0.540	0.641
GAL4 M08698_2.00	Saccharomyces cerevisiae	CGGVSNNVTNYNSNCCG	CGGNSNRNABNNSBCCG	Misc DeBoer et al.(2011) YPL248C_1510	0.540	0.641
GAL4 M11487_2.00	Saccharomyces cerevisiae	BYWCGGWSVAVWGHBVBCCGDDV	BHHCGGVBVDCWBTBSWCCGWRV	Transfac Matys et al.(2006) F$GAL4_01	0.540	0.641
GAL4 M11488_2.00	Saccharomyces cerevisiae	HKYWCGGHVVRVWGHBNBCCGD	HCGGVNVDCWBYBBDCCGWRMD	Transfac Matys et al.(2006) F$GAL4_C	0.540	0.641
For this family, TFs with SR scores > 0.537* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CAY68570	Zinc cluster	42	80	QACDSCRKRKLRCSKEYPKCSKCVTHKWSCVYSPRTVRS

Links
Other Zinc cluster family TFs
Other *Komagataella pastoris* TFs