CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ORGLA08G0220100 *(Oryza glaberrima)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	ORGLA08G0220100	T003942_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Q8GZQ2_MAIZE M09720_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1A_02	0.781	0.868
DREB1A M09710_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1A_01	0.772	0.849
DREB1A M09711_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$SED_Q2	0.772	0.849
Q8W236_WHEAT M09724_2.00	Triticum aestivum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CBF1_02	0.695	0.679
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ORGLA08G0220100.1	AP2	53	106	PVFRGVRRRGRAGRWVCEVRVPGRRGCRLWLGTFDAADAAARAHDAAMLALRGR

Links
Other AP2 family TFs
Other *Oryza glaberrima* TFs