CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

cassava19475.valid.m1 *(Manihot esculenta)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	cassava19475.valid.m1	T006830_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PK07402.1 M01097_2.00	Cannabis sativa	NVRCCGMCH	DGKCGGYBN	PBM Lambert et al.(2019) pTH11436	0.780	0.918
Q8H769_WHEAT M09721_2.00	Triticum aestivum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1_01	0.729	0.857
Q1ESI9_MAIZE M09714_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB2A_02	0.699	0.816
DREB2G M06662_2.00	Arabidopsis thaliana	DCCRCCGCYDYHDYH	DRHDRHRGCGGYGGH	Dap-seq OMalley et al.(2016) At5g18450_col_a	0.698	0.776
DREB2D M01611_2.00	Arabidopsis thaliana	NNRCCGHNN	NNDCGGYNN	PBM Weirauch et al.(2014) pTH8108	0.694	0.796
DREB2D M06597_2.00	Arabidopsis thaliana	YHNYYDCCRCCGYYD	HRRCGGYGGHRRNDR	Dap-seq OMalley et al.(2016) At1g75490_col_a	0.694	0.796
DREB2D M06598_2.00	Arabidopsis thaliana	HNNHDYCACCGHYWN	NWRDCGGTGRHDNND	Dap-seq OMalley et al.(2016) At1g75490_colamp_a	0.694	0.796
DREB2A M06655_2.00	Arabidopsis thaliana	NNNNHDHMACCGMCWYHNNNN	NNNNDRWGKCGGTKDHDNNNN	Dap-seq OMalley et al.(2016) DREB2_col_a	0.677	0.816
DREB2A M06656_2.00	Arabidopsis thaliana	NHNHMACCGMCWTWD	HWAWGKCGGTKDNDN	Dap-seq OMalley et al.(2016) DREB2_colamp_a	0.677	0.816
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
cassava19475.valid.m1	AP2	80	131	CNYRGVRQRTWGKWVAEIREPNRGPRLWLGTFPTAYEAALAYDEAARAMHGA

Links
Other AP2 family TFs
Other *Manihot esculenta* TFs

181 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
GF24707	Drosophila ananassae	FBgn0101700	I
GK24433	Drosophila willistoni	FBgn0226393	I
ACAC_0000856101	Angiostrongylus cantonensis	ACAC_0000856101	N
ACOC_0000143701	Angiostrongylus costaricensis	ACOC_0000143701	N
HCOI00019200	Haemonchus contortus	HCOI00019200	N
HPBE_0001776701	Heligmosomoides bakeri	HPBE_0001776701	N
HPLM_0000582601	Haemonchus placei	HPLM_0000582601	N
NBR_0002190901	Nippostrongylus brasiliensis	NBR_0002190901	N
NECAME_16059	Necator americanus	NECAME_16059	N
OESDEN_10833	Oesophagostomum dentatum	OESDEN_10833	N