CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

MDP0000250924 *(Malus domestica)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	MDP0000250924	T009053_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
DREB2D M01611_2.00	Arabidopsis thaliana	NNRCCGHNN	NNDCGGYNN	PBM Weirauch et al.(2014) pTH8108	0.774	0.939
DREB2D M06597_2.00	Arabidopsis thaliana	YHNYYDCCRCCGYYD	HRRCGGYGGHRRNDR	Dap-seq OMalley et al.(2016) At1g75490_col_a	0.774	0.939
DREB2D M06598_2.00	Arabidopsis thaliana	HNNHDYCACCGHYWN	NWRDCGGTGRHDNND	Dap-seq OMalley et al.(2016) At1g75490_colamp_a	0.774	0.939
DREB2G M06662_2.00	Arabidopsis thaliana	DCCRCCGCYDYHDYH	DRHDRHRGCGGYGGH	Dap-seq OMalley et al.(2016) At5g18450_col_a	0.727	0.816
PK07402.1 M01097_2.00	Cannabis sativa	NVRCCGMCH	DGKCGGYBN	PBM Lambert et al.(2019) pTH11436	0.692	0.816
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
MDP0000250924	AP2	118	169	CTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSYEAALAYDAAARKLYGS

Links
Other AP2 family TFs
Other *Malus domestica* TFs