CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

PV05_06033 *(Exophiala xenobiotica)* APSES
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF04383 (KilA-N)	IPR018004	PV05_06033	T012261_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
e_gw1.5.76.1 M01652_2.00	Nectria haematococca	NNVTGCABNN	NNVTGCABNN	PBM Weirauch et al.(2014) pTH9267	0.839	0.902
HCAG_07413 M01651_2.00	Histoplasma capsulatum	NNNHRYDNNN	NNNHRYDNNN	PBM Weirauch et al.(2014) pTH9346	0.819	0.939
stuA M01649_2.00	Aspergillus nidulans	NNTGCAKNNN	NNNMTGCANN	PBM Weirauch et al.(2014) pTH9236	0.692	0.890
stuA M09761_2.00	Aspergillus nidulans	DBDCGCGWWB	VWWCGCGHVH	Transfac Matys et al.(2006) F$STUAP_01	0.692	0.890
For this family, TFs with SR scores > 0.650* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
KIW57487	APSES	143	229	FQVEAKGVCVARREDNHFINGTKLLNVAGMTRGRRDGILKSEKTRHVVKIGPMHLKGVWIPFERALEFANKEKITDLLYPLFVHNIG

Links
Other APSES family TFs
Other *Exophiala xenobiotica* TFs