CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

MNT *(Macaca mulatta)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	ENSMMUG00000022004	T035453_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Mnt M01716_2.00	Mus musculus	NCACGTGNN	NNCACGTGN	PBM Weirauch et al.(2014) pTH4588	0.914	1.000
MNT M02774_2.00	Homo sapiens	NVCACGTGNH	DNCACGTGBN	SELEX Jolma et al.(2013) MNT_1	0.914	1.000
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSMMUP00000028981	bHLH	223	272	EVHNKLEKNRRAHLKECFETLKRNIPNVDDKKTSNLSVLRTALRYIQSLK

Links
Other bHLH family TFs
Other *Macaca mulatta* TFs