CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GF17529 *(Drosophila ananassae)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	FBgn0094547	T038547_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
cwo M03623_2.00	Drosophila melanogaster	DRRTCACGTGAYYH	DRRTCACGTGAYYH	SELEX Nitta et al.(2015) cwo_1	0.914	1.000
cwo M03624_2.00	Drosophila melanogaster	RKCACGTGMY	RKCACGTGMY	SELEX Nitta et al.(2015) cwo_2	0.914	1.000
cwo M03625_2.00	Drosophila melanogaster	NDCACGTGHNNNDCACGTGHN	NDCACGTGHNNNDCACGTGHN	SELEX Nitta et al.(2015) cwo_3	0.914	1.000
cwo M06001_2.00	Drosophila melanogaster	RTCACGTGACCR	YGGTCACGTGAY	B1H Zhu et al.(2011) cwo_SANGER_5_FBgn0259938	0.914	1.000
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
FBpp0120721	bHLH	65	118	LSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKGRGRIEKTEIIEMAIRHLKHLQ

Links
Other bHLH family TFs
Other *Drosophila ananassae* TFs