CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Tal_R011867 *(Tyto alba)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00010 (HLH)	IPR001092	Tal_R011867	T047813_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Ahr M08747_2.00	Mus musculus	DCACGCNMH	DKNGCGTGH	Misc Kulakovskiy et al.(2013) AHR_MOUSE.H11MO.0.B	0.894	0.957
AHR M08716_2.00	Homo sapiens	DCACGCNMH	DKNGCGTGH	Misc Kulakovskiy et al.(2013) AHR_HUMAN.H11MO.0.B	0.894	0.936
AHR M09816_2.00	Homo sapiens	WSTCACGCDASYYBGRRS	SYYCVRRSTHGCGTGASW	Transfac Matys et al.(2006) V$AHR_01	0.894	0.936
AHR M09817_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$AHR_Q5	0.894	0.936
AHR M09818_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$AHR_Q6_01	0.894	0.936
AHR M09819_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$AHR_Q6	0.894	0.936
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Tal_R011867	bHLH	12	58	NPSKRHRDRLNAELDRLASLLPFPQDVIAKLDKLSVLRLSVSYLRAK

Links
Other bHLH family TFs
Other *Tyto alba* TFs