CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Bostr.5325s0049 *(Boechera stricta)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00010 (HLH)	IPR001092	Bostr.5325s0049	T049162_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
BHLH13 M01698_2.00	Arabidopsis thaliana	MCACGTGV	BCACGTGK	PBM Weirauch et al.(2014) pTH7565	0.914	1.000
PK18474.1 M01127_2.00	Cannabis sativa	NRCACGTGCN	NGCACGTGYN	PBM Lambert et al.(2019) pTH10273	0.879	0.898
PK18474.1 M01768_2.00	Cannabis sativa	NCACGWK	MWCGTGN	PBM Weirauch et al.(2014) pTH9589	0.879	0.898
MYC2 M01699_2.00	Arabidopsis thaliana	NNCACGTGNN	NNCACGTGNN	PBM Weirauch et al.(2014) pTH8083	0.879	0.878
MYC3 M01712_2.00	Arabidopsis thaliana	MWYGTGNNNN	NNNNCACRWK	PBM Weirauch et al.(2014) pTH8854	0.879	0.878
MYC4 M01707_2.00	Arabidopsis thaliana	NNCACGTGNN	NNCACGTGNN	PBM Weirauch et al.(2014) pTH8260	0.879	0.857
OS01G0235700 M09894_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$BHLH66_01	0.879	0.857
AT2G22750 M06730_2.00	Arabidopsis thaliana	MRYGTKDNHCACGTGNN	NNCACGTGDNHMACRYK	Dap-seq OMalley et al.(2016) bHLH18_col_a	0.846	0.571
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bostr.5325s0049.1.p	bHLH	264	312	ALNHVEAERQRREKLNQRFYALRSVVPNISKMDKASLLGDAVSYINELH

Links
Other bHLH family TFs
Other *Boechera stricta* TFs