CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

CAGL0H04631g *(Candida glabrata)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	CAGL0H04631g	T057845_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
YAP1 M01524_2.00	Saccharomyces cerevisiae	NMTKABNHNN	NNDNVTMAKN	PBM Zhu et al.(2009) Yap1	0.816	0.710
YAP1 M08501_2.00	Saccharomyces cerevisiae	TTAYSTAA	TTASRTAA	Misc DeBoer et al.(2011) YML007W_1408	0.816	0.710
YAP1 M08502_2.00	Saccharomyces cerevisiae	KMTKACTAATNN	NNATTAGTMAKM	Misc DeBoer et al.(2011) YML007W_883	0.816	0.710
YAP1 M10061_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$YAP1_Q3	0.816	0.710
YAP1 M10062_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$YAP1_Q4	0.816	0.710
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CAG59929	bZIP	25	87	PETRMKRVAQNRAAQKAFRERKERKMKELERKVVDLENLTKLNEVETNFLRDQLSILVKELRK

Links
Other bZIP family TFs
Other *Candida glabrata* TFs