CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GNLVRS01_PISO0A10934g *(Millerozyma farinosa)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	GNLVRS01_PISO0A10934g	T063057_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
asl-1 M01147_2.00	Neurospora crassa	NVTKACGHNN	NNDCGTMABN	PBM Lambert et al.(2019) pTH8918	0.791	0.375
CST6 M00014_2.00	Saccharomyces cerevisiae	RTGACGTH	DACGTCAY	PBM Badis et al.(2008) CST6_4521	0.789	0.500
CST6 M00906_2.00	Saccharomyces cerevisiae	NRTGACGTHN	NDACGTCAYN	PBM Gordan et al.(2011) Cst6	0.789	0.500
CST6 M07444_2.00	Saccharomyces cerevisiae	RTGACGTHN	NDACGTCAY	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0286.1	0.789	0.500
CST6 M08499_2.00	Saccharomyces cerevisiae	RTGACGTHN	NDACGTCAY	Misc DeBoer et al.(2011) YIL036W_585	0.789	0.500
ACA1 M08494_2.00	Saccharomyces cerevisiae	TKACGTMA	TKACGTMA	Misc DeBoer et al.(2011) YER045C_8	0.786	0.438
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CCE72907	bZIP	246	309	TAAWKKERLLERNRIAASRCRQRKKQAQQQLQDTVNNLEMKNKDLSDELEVYKSALGNIKSLID

Links
Other bZIP family TFs
Other *Millerozyma farinosa* TFs