CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ENSMPUG00000003195 *(Mustela putorius furo)* EBF1
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF16422 (COE1_DBD)	(none)	ENSMPUG00000003195	T174609_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Ebf2 M10467_2.00	Mus musculus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$COE2_01	0.996	0.996
EBF3 M10461_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$EBF_Q6	0.887	0.887
Ebf1 M09045_2.00	Mus musculus	DBYCCCWRGGGAV	BTCCCYWGGGRVH	Misc Kulakovskiy et al.(2013) COE1_MOUSE.H11MO.0.A	0.857	0.857
Ebf1 M09527_2.00	Mus musculus	DBTCCCHDGGGA	TCCCHDGGGAVH	Misc Heinz et al.(2010) proBcell-EBF_GSE21978	0.857	0.857
Ebf1 M10469_2.00	Mus musculus	VYMHVYYCYYBRGGGAVTHKHB	VDMDABTCCCYVRRGRRBDKRB	Transfac Matys et al.(2006) V$OLF1_01	0.857	0.857
EBF4 M10460_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$EBF4_02	0.827	0.827
Ebf4 M10468_2.00	Mus musculus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$EBF4_01	0.823	0.823
kn M03721_2.00	Drosophila melanogaster	BWATTCCCHDGGGAATWV	BWATTCCCHDGGGAATWV	SELEX Nitta et al.(2015) kn_1	0.727	0.727
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSMPUP00000003162	EBF1	16	246	EKSLGAEMDSVRSWVRNVGVVDANVAAQSGVALSRAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVENDKEQGNEKTNNGTHYKLQLLYSNGVRTEQDLYVRLIDSVTKQPIAYEGQNKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKTAGNPRDMRRFQVVLSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRL

Links
Other EBF1 family TFs
Other *Mustela putorius furo* TFs

350 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
Smp_124780	Schistosoma mansoni	Smp_124780	N
A_03997	Schistosoma haematobium	A_03997	N
DILT_0000838801	Diphyllobothrium latum	DILT_0000838801	N
EmuJ_000502000	Echinococcus multilocularis	EmuJ_000502000	N
HmN_000775400	Hymenolepis microstoma	HmN_000775400	N
HNAJ_0000095701	Hymenolepis nana	HNAJ_0000095701	N
MCOS_0000093001	Mesocestoides corti	MCOS_0000093001	N
T265_11252	Opisthorchis viverrini	T265_11252	N
TRE_0000637801	Trichobilharzia regenti	TRE_0000637801	N
TsM_000140500	Taenia solium	TsM_000140500	N