CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Bra033533 *(Brassica rapa)* GATA
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00320 (GATA)	IPR000679	Bra033533	T191978_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
GATA16 M06897_2.00	Arabidopsis thaliana	ATGATGATGATSATGATGATGATSATG	CATSATCATCATCATSATCATCATCAT	Dap-seq OMalley et al.(2016) GATA16_col_a	0.823	0.806
GATA15 M01997_2.00	Arabidopsis thaliana	NNHGATCNN	NNGATCDNN	PBM Weirauch et al.(2014) pTH7662	0.803	0.806
GATA15 M06886_2.00	Arabidopsis thaliana	GATGATGATGATGATGATS	SATCATCATCATCATCATC	Dap-seq OMalley et al.(2016) GATA15_col_b	0.803	0.806
For this family, TFs with SR scores > 0.802* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bra033533.1-P	GATA	40	75	CVDCGTNKTPLWRGGPAGPKSLCNACGIKSRKKRQA

Links
Other GATA family TFs
Other *Brassica rapa* TFs